Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Saxiphilin Recombinant Protein (American bullfrog) (OPCA04309)

* Required Fields

$0.00
In Stock
Gene Symbol:
Saxiphilin
Alias Symbols:
SAX
Description of Target:
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Swissprot Id:
P31226
Protein Name:
Saxiphilin
Molecular Weight:
42 kDa
Product Format:
Liquid
Species Reactivity:
American bullfrog
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Partial: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Storage Buffer:
Tris-base, 50% glycerol
Source:
Yeast
Additional Information:
Species Specificity Detail: American bullfrog
Tag:
N-terminal 6xHis-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Purification and partial sequencing of saxiphilin, a saxitoxin-binding protein from the bullfrog, reveals homology to transferrin.Li Y., Moczydlowski E.J. Biol. Chem. 266:15481-15487(1991)
Datasheets/Manuals:
Printable datasheet for OPCA04309
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...