Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Rph3a antibody - N-terminal region (ARP59498_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP59498_P050-FITC Conjugated

ARP59498_P050-HRP Conjugated

ARP59498_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Rph3a
NCBI Gene Id:
19894
Official Gene Full Name:
Rabphilin 3A
Protein Name:
Rabphilin-3A
Swissprot Id:
P47708
Protein Accession #:
NP_035416
Nucleotide Accession #:
NM_011286
Alias Symbols:
2900002P20Rik, AU022689, AW108370
Description of Target:
RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Protein Size (# AA):
681
Molecular Weight:
75kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Rph3a.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Rph3a.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 83%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Complete computational species homology data:
Anti-Rph3a (ARP59498_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CALM1; Rab3a; Rab27b; Rab27a; Rab8a; Rab3d; Rab3c; Rab3b;
Blocking Peptide:
For anti-Rph3a (ARP59498_P050) antibody is Catalog # AAP59498 (Previous Catalog # AAPP45595)
Datasheets/Manuals:
Printable datasheet for anti-Rph3a (ARP59498_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...