Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ROCK2 Antibody (OAAF08020)

100 ug
In Stock

Conjugation Options

OAAF08020-FITC Conjugated

OAAF08020-HRP Conjugated

OAAF08020-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
ROCK2, KIAA0619, Rho-associated protein kinase 2, Rho kinase 2, Rho-associated, coiled-coil-containing protein kinase 2, Rho-associated, coiled-coil-containing protein kinase II, ROCK-II, p164 ROCK-2
Replacement Item:
This antibody may replace item sc-100425 from Santa Cruz Biotechnology.
Molecular Weight:
160 kDa
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ROCK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ROCK2.
The antiserum was produced against synthesized peptide derived from the Internal region of human ROCK2.
Species Reactivity:
Human, Mouse, Rat
Peptide Sequence:
Synthetic peptide located within the following region: EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMEL
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Printable datasheet for OAAF08020
ROCK2 Antibody detects endogenous levels of ROCK2 protein.
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
ELISA: 1:10000
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...