Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Rgs10 antibody - N-terminal region (ARP42856_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42856_P050-FITC Conjugated

ARP42856_P050-HRP Conjugated

ARP42856_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Regulator of G-protein signalling 10
Protein Name:
Regulator of G-protein signaling 10
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
2310010N19Rik, MGC129414
Replacement Item:
This antibody may replace item sc-28835 from Santa Cruz Biotechnology.
Description of Target:
Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Rgs10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Rgs10.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 100%
Complete computational species homology data:
Anti-Rgs10 (ARP42856_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Rgs10 (ARP42856_P050) antibody is Catalog # AAP42856 (Previous Catalog # AAPS10710)
Printable datasheet for anti-Rgs10 (ARP42856_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...