Now Offering Over 102,157 Antibodies & 44,722 Antigens!

REST antibody - middle region (ARP32478_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32478_P050-FITC Conjugated

ARP32478_P050-HRP Conjugated

ARP32478_P050-Biotin Conjugated

Gene Symbol:
REST
NCBI Gene Id:
5978
Official Gene Full Name:
RE1-silencing transcription factor
Protein Name:
RE1-silencing transcription factor
Swissprot Id:
Q13127
Protein Accession #:
NP_005603
Nucleotide Accession #:
NM_005612
Alias Symbols:
NRSF, XBR
Replacement Item:
This antibody may replace item sc-25398 from Santa Cruz Biotechnology.
Description of Target:
REST is a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis.This gene encodes a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis. Alternatively spliced transcript variants have been described; however, their full length nature has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
1097
Molecular Weight:
122kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express REST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express REST.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human REST
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-REST (ARP32478_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BTRC; UBC; FBXW11; CSNK1E; NEDD8; EHMT2; EIF4A3; FBXW4; FBXW7; FBXW5; FBXW8; FBXW2; SIN3A; TERF2; GRIA2; SUB1; GTF2B; Tbp; SIN3B; HDAC1; RCOR1; SP1; SMARCE1; SMARCC2; SMARCA4; CDYL; HDAC5; HDAC4; HTT; NCOR1; KDM5C; RNF2; HDAC2; STMN2; GRM2; CTDSP1;
Blocking Peptide:
For anti-REST (ARP32478_P050) antibody is Catalog # AAP32478 (Previous Catalog # AAPP03477)
Datasheets/Manuals:
Printable datasheet for anti-REST (ARP32478_P050) antibody
Sample Type Confirmation:

REST is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Miyajima,F., (er) Genes Brain Behav. (2008) In press
Publications:

Mehta, SL; Kim, T; Vemuganti, R; Long Noncoding RNA FosDT Promotes Ischemic Brain Injury by Interacting with REST-Associated Chromatin-Modifying Proteins. 35, 16443-9 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26674869

Tell us what you think about this item!

Write A Review
    Please, wait...