Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NKD1 antibody - N-terminal region : FITC (ARP41285_P050-FITC)

Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP41285_P050 Unconjugated

ARP41285_P050-HRP Conjugated

ARP41285_P050-Biotin Conjugated

Gene Symbol:
NKD1
NCBI Gene Id:
85407
Official Gene Full Name:
Naked cuticle homolog 1 (Drosophila)
Protein Name:
Protein naked cuticle homolog 1
Swissprot Id:
Q969G9
Protein Accession #:
NP_149110
Nucleotide Accession #:
NM_033119
Alias Symbols:
Naked1
Replacement Item:
This antibody may replace item sc-102039 from Santa Cruz Biotechnology.
Description of Target:
In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM].
Protein Size (# AA):
470
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NKD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NKD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NKD1
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Complete computational species homology data:
Anti-NKD1 (ARP41285_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
DVL3;
Blocking Peptide:
For anti-NKD1 (ARP41285_P050-FITC) antibody is Catalog # AAP41285 (Previous Catalog # AAPP12424)
Datasheets/Manuals:
Printable datasheet for anti-NKD1 (ARP41285_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
Target Reference:
Yan,D., (2001) Proc. Natl. Acad. Sci. U.S.A. 98 (26), 14973-14978
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...