Now Offering Over 102,157 Antibodies & 44,722 Antigens!

STAT3 antibody - N-terminal region (ARP38253_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP38253_P050-FITC Conjugated

ARP38253_P050-HRP Conjugated

ARP38253_P050-Biotin Conjugated

Gene Symbol:
STAT3
NCBI Gene Id:
6774
Official Gene Full Name:
Signal transducer and activator of transcription 3 (acute-phase response factor)
Protein Name:
Signal transducer and activator of transcription 3 isoform 2 EMBL BAG70046.1
Swissprot Id:
B5BTZ6
Protein Accession #:
NP_003141
Nucleotide Accession #:
NM_003150
Alias Symbols:
APRF, FLJ20882, MGC16063, HIES
Replacement Item:
This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
Description of Target:
STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
769
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, IF
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-STAT3 (ARP38253_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MTOR; GADD45A; BMX; BLK; UBC; SYK; LMO2; SRI; HIC1; GNB2; USP22; RELA; COPS5; BRD4; ADRB2; PSMG3; TBCD; TBC1D15; PUS7; LUC7L2; ARFIP1; IVNS1ABP; MSH2; BMH1; SIN3A; EGFR; PIAS3; HDAC3; SRC; LYN; JAK3; JAK2; HES5; TRIM28; HES1; HCK; FYN; FGR; HNRNPM; SULT2A
Blocking Peptide:
For anti-STAT3 (ARP38253_P050) antibody is Catalog # AAP38253 (Previous Catalog # AAPP23107)
Datasheets/Manuals:
Printable datasheet for anti-STAT3 (ARP38253_P050) antibody
Additional Information:
IHC Information: Kidney
IHC Information: Uterus
IHC Information: Prostate
Target Reference:
Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Publications:

Deng, W. et al. Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway. Cytotherapy 13, 431-40 (2011). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21174489

Vega, V. L. et al. Activation of the stress response in macrophages alters the M1/M2 balance by enhancing bacterial killing and IL-10 expression. J. Mol. Med. (Berl). (2014). doi:10.1007/s00109-014-1201-y IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25163764

Deng, W; Chen, QW; Li, XS; Yuan, ZM; Li, GQ; Ke, DZ; Wang, L; Wu, ZQ; Luo, SL; Bone marrow mesenchymal stromal cells with CD47 high expression via the signal transducer and activators of transcription signaling pathway preventing myocardial fibrosis. 8, 10555-64 (2015). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26617765

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

289/10/2017 16:06
  • Quality:
  • Overall Experience:
Product Review: STAT3 antibody - N-terminal region (ARP38253_P050)
Great product
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...