website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PIK3CB antibody - C-terminal region (ARP32117_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP32117_T100-FITC Conjugated

ARP32117_T100-HRP Conjugated

ARP32117_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Phosphoinositide-3-kinase, catalytic, beta polypeptide
Protein Name:
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-29447 from Santa Cruz Biotechnology.
Description of Target:
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIK3CB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIK3CB.
The immunogen is a synthetic peptide directed towards the C terminal region of human PIK3CB
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PIK3CB (ARP32117_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PIK3CB (ARP32117_T100) antibody is Catalog # AAP32117 (Previous Catalog # AAPP03034)
Datasheets / Downloads:
Printable datasheet for anti-PIK3CB (ARP32117_T100) antibody
beta isoform
Target Reference:
Zhao,J.J., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (51), 18443-18448

Product Protocols: PIK3CB antibody tested with Human Fetal Brain Tissue (ARP32117_T100)

Aviva Systems Biology is the original manufacturer of this PIK3CB antibody (ARP32117_T100)

Click here to view the PIK3CB antibody Western Blot Protocol

Product Datasheet Link: PIK3CB antibody (ARP32117_T100)

WB Suggested Anti-PIK3CB Antibody Titration: 5ug/ml
Positive Control: Fetal brain

Western Blot image:

Description of Target: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PIK3CB antibody (ARP32117_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...