Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Recombinant Apis mellifera Major royal jelly protein 1 (OPCA00284)

$255.00
In Stock
Description of Target:
Recombinant Apis mellifera Major royal jelly protein 1
Purity:
>90% (SDS-PAGE)
Source:
E.coli
Peptide Sequence:
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
Additional Information:
Tag information : GST tag
Reconstitution and Storage:
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Datasheets/Manuals:
Printable datasheet for Recombinant Apis mellifera Major royal jelly protein 1 (OPCA00284)OPCA00284
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...