Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RCAN1 antibody - middle region (ARP38457_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38457_P050-FITC Conjugated

ARP38457_P050-HRP Conjugated

ARP38457_P050-Biotin Conjugated

Gene Symbol:
RCAN1
NCBI Gene Id:
1827
Official Gene Full Name:
Regulator of calcineurin 1
Protein Name:
Calcipressin-1
Swissprot Id:
P53805
Protein Accession #:
NP_004405
Nucleotide Accession #:
NM_004414
Alias Symbols:
ADAPT78, CSP1, DSC1, DSCR1, MCIP1, RCN1
Replacement Item:
This antibody may replace item sc-119849 from Santa Cruz Biotechnology.
Description of Target:
RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene.
Protein Size (# AA):
252
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RCAN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RCAN1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RCAN1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-RCAN1 (ARP38457_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PPP3CA; NEDD8; APP; FBXW11; BTRC; FBXW4; TOLLIP; TRAF6; IRAK1; HSP90AA1; STAT2; GSK3B; MAP3K3; MAPK3; UXT;
Blocking Peptide:
For anti-RCAN1 (ARP38457_P050) antibody is Catalog # AAP38457 (Previous Catalog # AAPP23169)
Datasheets/Manuals:
Printable datasheet for anti-RCAN1 (ARP38457_P050) antibody
Target Reference:
Riper,D.V., (2008) Arch. Biochem. Biophys. 472 (1), 43-50
Publications:

Voronov, I. et al. The R740S mutation in the V-ATPase a3 subunit increases lysosomal pH, impairs NFATc1 translocation, and decreases in vitro osteoclastogenesis. J. Bone Miner. Res. 28, 108-18 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22865292

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

73/03/2018 16:28
  • Overall Experience:
  • Quality:
Mouse Osteoclast in WB

Strong signal, but a few non-specific bands.

-submitted by
Irina Voronov
University of Toronto

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...