Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RBBP9 Antibody (ARP34703_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34703_P050-FITC Conjugated

ARP34703_P050-HRP Conjugated

ARP34703_P050-Biotin Conjugated

Gene Symbol:
RBBP9
NCBI Gene Id:
10741
Official Gene Full Name:
Retinoblastoma binding protein 9
Protein Name:
Putative hydrolase RBBP9
Swissprot Id:
O75884
Protein Accession #:
NP_006597
Nucleotide Accession #:
NM_006606
Alias Symbols:
BOG, MGC9236, RBBP10
Replacement Item:
This antibody may replace item sc-101111 from Santa Cruz Biotechnology.
Description of Target:
RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Protein Size (# AA):
186
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBBP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBBP9.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 91%
Complete computational species homology data:
Anti-RBBP9 (ARP34703_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RB1; TERF2IP; UBC; YRDC; RBL2; RBL1;
Blocking Peptide:
For anti-RBBP9 (ARP34703_P050) antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651)
Datasheets/Manuals:
Printable datasheet for anti-RBBP9 (ARP34703_P050) antibody
Target Reference:
Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169

Tell us what you think about this item!

Write A Review
    Please, wait...