Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RACK1 Antibody - C-terminal region (ARP40625_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40625_P050-FITC Conjugated

ARP40625_P050-HRP Conjugated

ARP40625_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
receptor for activated C kinase 1
Protein Name:
receptor of activated protein C kinase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1
Replacement Item:
This antibody may replace item sc-10775 from Santa Cruz Biotechnology.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RACK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RACK1.
The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-GNB2L1 (ARP40625_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RACK1 (ARP40625_P050) antibody is Catalog # AAP40625 (Previous Catalog # AAPP22781)
Printable datasheet for anti-RACK1 (ARP40625_P050) antibody
Sample Type Confirmation:

GNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

beta-2-like 1
Target Reference:
Zhang,W., (2006) Mol. Cell. Biol. 26 (2), 413-424

Tell us what you think about this item!

Write A Review
    Please, wait...