Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RAB35 antibody - middle region (ARP52268_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP52268_P050-FITC Conjugated

ARP52268_P050-HRP Conjugated

ARP52268_P050-Biotin Conjugated

Gene Symbol:
RAB35
NCBI Gene Id:
11021
Official Gene Full Name:
RAB35, member RAS oncogene family
Protein Name:
Ras-related protein Rab-35
Swissprot Id:
Q15286
Protein Accession #:
NP_006852
Nucleotide Accession #:
NM_006861
Alias Symbols:
H-ray, RAB1C, RAY
Replacement Item:
This antibody may replace item sc-109473 from Santa Cruz Biotechnology.
Description of Target:
RAB35 possesses GTPase activity.
Protein Size (# AA):
201
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAB35.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAB35.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RAB35
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-RAB35 (ARP52268_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RPA3; RPA2; RPA1; AMOT; LATS1; Ccdc64b; IQCB1; UBL4A; FN1; ATP6V1B1; APP; ATG16L1; ALK; TBPL1; C2orf44; CBR3; IDH3B; GNPAT; PTPRS;
Blocking Peptide:
For anti-RAB35 (ARP52268_P050) antibody is Catalog # AAP52268 (Previous Catalog # AAPP44029)
Datasheets/Manuals:
Printable datasheet for anti-RAB35 (ARP52268_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...