Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PYCR2 antibody - middle region (ARP54937_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP54937_P050-FITC Conjugated

ARP54937_P050-HRP Conjugated

ARP54937_P050-Biotin Conjugated

Gene Symbol:
PYCR2
NCBI Gene Id:
29920
Official Gene Full Name:
Pyrroline-5-carboxylate reductase family, member 2
Protein Name:
Pyrroline-5-carboxylate reductase 2
Swissprot Id:
Q96C36
Protein Accession #:
NP_037460
Nucleotide Accession #:
NM_013328
Alias Symbols:
P5CR2
Replacement Item:
This antibody may replace item sc-138500 from Santa Cruz Biotechnology.
Description of Target:
PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
Protein Size (# AA):
320
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, IP
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYCR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYCR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PYCR2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PYCR2 (ARP54937_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; UBC; MDM2; VCAM1; SKIL; MDC1; APP; CIC; KCND3; CUL3; EBNA-LP; ICT1; TERF2;
Blocking Peptide:
For anti-PYCR2 (ARP54937_P050) antibody is Catalog # AAP54937 (Previous Catalog # AAPP31892)
Datasheets/Manuals:
Printable datasheet for anti-PYCR2 (ARP54937_P050) antibody
Target Reference:
Lim,J., (2006) Cell 125 (4), 801-814

Tell us what you think about this item!

Write A Review
    Please, wait...