Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PYCR2 antibody - C-terminal region (ARP54938_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP54938_P050-FITC Conjugated

ARP54938_P050-HRP Conjugated

ARP54938_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Pyrroline-5-carboxylate reductase family, member 2
Protein Name:
Pyrroline-5-carboxylate reductase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-138500 from Santa Cruz Biotechnology.
Description of Target:
PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYCR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYCR2.
The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-PYCR2 (ARP54938_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PYCR2 (ARP54938_P050) antibody is Catalog # AAP54938 (Previous Catalog # AAPP31893)
Printable datasheet for anti-PYCR2 (ARP54938_P050) antibody
Target Reference:
Lim,J., (2006) Cell 125 (4), 801-814

Tell us what you think about this item!

Write A Review
    Please, wait...