Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PYCR1 antibody - middle region (ARP57751_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP57751_P050-FITC Conjugated

ARP57751_P050-HRP Conjugated

ARP57751_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Pyrroline-5-carboxylate reductase 1
Protein Name:
Pyrroline-5-carboxylate reductase 1, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYCR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYCR1.
The immunogen is a synthetic peptide directed towards the middle region of human PYCR1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-PYCR1 (ARP57751_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PYCR1 (ARP57751_P050) antibody is Catalog # AAP57751 (Previous Catalog # AAPP38808)
Printable datasheet for anti-PYCR1 (ARP57751_P050) antibody
Sample Type Confirmation:

PYCR1 is supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Target Reference:
Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Tell us what you think about this item!

Write A Review
    Please, wait...