Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PYCR1 antibody - middle region (ARP57750_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP57750_P050-FITC Conjugated

ARP57750_P050-HRP Conjugated

ARP57750_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PYCR1
NCBI Gene Id:
5831
Official Gene Full Name:
Pyrroline-5-carboxylate reductase 1
Protein Name:
Pyrroline-5-carboxylate reductase 1, mitochondrial
Swissprot Id:
A6NFM2
Protein Accession #:
NP_722546
Nucleotide Accession #:
NM_153824
Alias Symbols:
P5C, P5CR, PIG45, PP222, PYCR, PRO3, ARCL2B, ARCL3B
Description of Target:
This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Protein Size (# AA):
316
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYCR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYCR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PYCR1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PYCR1 (ARP57750_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; SUMO2; NEDD8; MDM2; SUZ12; RNF2; BMI1; HNRNPD; BAG3; BNIPL; UBC; ITGA4; DAB2; MDC1; CUL3; NUDT21; CDK2AP2;
Blocking Peptide:
For anti-PYCR1 (ARP57750_P050) antibody is Catalog # AAP57750 (Previous Catalog # AAPP38807)
Datasheets/Manuals:
Printable datasheet for anti-PYCR1 (ARP57750_P050) antibody
Sample Type Confirmation:

PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

Target Reference:
Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Tell us what you think about this item!

Write A Review
    Please, wait...