Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PSMA1 antibody - C-terminal region (ARP40417_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40417_P050-FITC Conjugated

ARP40417_P050-HRP Conjugated

ARP40417_P050-Biotin Conjugated

Gene Symbol:
PSMA1
NCBI Gene Id:
5682
Official Gene Full Name:
Proteasome (prosome, macropain) subunit, alpha type, 1
Protein Name:
Proteasome subunit alpha type-1
Swissprot Id:
P25786
Protein Accession #:
NP_002777
Nucleotide Accession #:
NM_002786
Alias Symbols:
HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30
Replacement Item:
This antibody may replace item sc-112756 from Santa Cruz Biotechnology.
Description of Target:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Protein Size (# AA):
263
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSMA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSMA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PSMA1 (ARP40417_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRDM14; CEP70; CCDC102B; GNPTAB; CEP72; KCTD9; ROPN1; ABI3; SH3GLB1; APIP; LDOC1; MTUS2; MAPRE3; MAPRE1; IKZF3; MID2; EHMT2; PNMA2; IKZF1; TRIM10; HUWE1; HOMER3; PNMA1; KRT38; BLZF1; MAD1L1; MKRN3; REL; PSMA3; MLH1; KRT31; KRT15; KRTAP5-9; GOLGA2; CDA; CC
Blocking Peptide:
For anti-PSMA1 (ARP40417_P050) antibody is Catalog # AAP40417 (Previous Catalog # AAPP23493)
Datasheets/Manuals:
Printable datasheet for anti-PSMA1 (ARP40417_P050) antibody
Sample Type Confirmation:

PSMA1 is strongly supported by BioGPS gene expression data to be expressed in NCI460

Subunit:
alpha type-1
Target Reference:
Conticello,S.G., (2003) Curr. Biol. 13 (22), 2009-2013
Publications:

Cron, K. R. et al. Proteasome inhibitors block DNA repair and radiosensitize non-small cell lung cancer. PLoS One 8, e73710 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24040035

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...