Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZSC12 Antibody - N-terminal region : HRP (ARP39130_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP39130_P050 Unconjugated

ARP39130_P050-FITC Conjugated

ARP39130_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
ZSCAN12, KIAA0426, ZNF305, ZNF96,
Description of Target:
ZSC12 may be involved in transcriptional regulation.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZSC12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZSC12.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.6-0.7 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZSC12 (ARP39130_P050-HRP) antibody is Catalog # AAP39130
Datasheets / Downloads:
Printable datasheet for anti-ZSC12 (ARP39130_P050-HRP) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...