Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZSC12 Antibody - N-terminal region : FITC (ARP39130_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP39130_P050 Unconjugated

ARP39130_P050-HRP Conjugated

ARP39130_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZSC12
NCBI Gene Id:
9753
Swissprot Id:
O43309
Protein Accession #:
NP_055539
Alias Symbols:
ZSCAN12, KIAA0426, ZNF305, ZNF96,
Description of Target:
ZSC12 may be involved in transcriptional regulation.
Protein Size (# AA):
604
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZSC12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZSC12.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
KRTAP10-1; SSX2IP; ZNF496; CEP70; ZKSCAN7; ZSCAN32; ZNF473; TFIP11; MTUS2; MID2; ZSCAN12; SUMO1;
Blocking Peptide:
For anti-ZSC12 (ARP39130_P050-FITC) antibody is Catalog # AAP39130
Datasheets/Manuals:
Printable datasheet for anti-ZSC12 (ARP39130_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Tell us what you think about this item!

Write A Review
    Please, wait...