Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF776 Antibody - middle region : HRP (ARP32527_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP32527_P050 Unconjugated

ARP32527_P050-FITC Conjugated

ARP32527_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF776
NCBI Gene Id:
284309
Swissprot Id:
Q68DI1
Protein Accession #:
NP_775903
Alias Symbols:
ZNF776,
Description of Target:
ZNF776 may be involved in transcriptional regulation.
Protein Size (# AA):
518
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF776.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF776.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Blocking Peptide:
For anti-ZNF776 (ARP32527_P050-HRP) antibody is Catalog # AAP32527
Datasheets / Downloads:
Printable datasheet for anti-ZNF776 (ARP32527_P050-HRP) antibody
Conjugation:
HRP
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...