Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF618 Antibody - middle region : FITC (ARP32229_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP32229_P050 Unconjugated

ARP32229_P050-HRP Conjugated

ARP32229_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF618
NCBI Gene Id:
114991
Official Gene Full Name:
zinc finger protein 618
Protein Name:
zinc finger protein 618
Swissprot Id:
Q5T7W0
Alias Symbols:
NEDD10, FP13169
Protein Size (# AA):
954
Molecular Weight:
104kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF618.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF618.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ZN618
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CSNK1A1;
Blocking Peptide:
For anti-ZNF618 (ARP32229_P050-FITC) antibody is Catalog # AAP32229
Datasheets/Manuals:
Printable datasheet for anti-ZNF618 (ARP32229_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Tell us what you think about this item!

Write A Review
    Please, wait...