Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZN618 Antibody - middle region : FITC (ARP32229_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock

Conjugation Options

ARP32229_P050 Unconjugated

ARP32229_P050-HRP Conjugated

ARP32229_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
ZNF618, KIAA1952,
Description of Target:
ZN618 may be involved in transcriptional regulation.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZN618.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZN618.
The immunogen is a synthetic peptide directed towards the middle region of Human ZN618
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZN618 (ARP32229_P050-FITC) antibody is Catalog # AAP32229
Printable datasheet for anti-ZN618 (ARP32229_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Tell us what you think about this item!

Write A Review
    Please, wait...