Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TBX20 Antibody - N-terminal region : FITC (ARP33176_P050-FITC)

Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP33176_P050 Unconjugated

ARP33176_P050-HRP Conjugated

ARP33176_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134061 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX20.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX20.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TBX20
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: RANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TBX20 (ARP33176_P050-FITC) antibody is Catalog # AAP33176
Printable datasheet for anti-TBX20 (ARP33176_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...