Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PHF11 Antibody - N-terminal region : FITC (ARP34847_P050-FITC)

Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP34847_P050 Unconjugated

ARP34847_P050-HRP Conjugated

ARP34847_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-152207 from Santa Cruz Biotechnology.
Description of Target:
PHF11 is a positive regulator of Th1-type cytokine gene expression.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PHF11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PHF11.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PHF11
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: CEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PHF11 (ARP34847_P050-FITC) antibody is Catalog # AAP34847
Datasheets / Downloads:
Printable datasheet for anti-PHF11 (ARP34847_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...