Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MLX Antibody - N-terminal region : Biotin (ARP51650_P050-Biotin)

100 ul
In Stock

Conjugation Options

ARP51650_P050 Unconjugated

ARP51650_P050-FITC Conjugated

ARP51650_P050-HRP Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-111152 from Santa Cruz Biotechnology.
Description of Target:
The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MLX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MLX.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MLX
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Blocking Peptide:
For anti-MLX (ARP51650_P050-Biotin) antibody is Catalog # AAP76226
Printable datasheet for anti-MLX (ARP51650_P050-Biotin) antibody
Target Reference:

Tell us what you think about this item!

Write A Review
    Please, wait...