Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MAP2K4 Antibody - C-terminal region : HRP (ARP30544_T100-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock

Conjugation Options

ARP30544_T100 Unconjugated

ARP30544_T100-FITC Conjugated

ARP30544_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the mitogen-activated protein kinase (MAPK) family. Members of this family act as an integration point for multiple biochemical signals and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. They form a three-tiered signaling module composed of MAPKKKs, MAPKKs, and MAPKs. This protein is phosphorylated at serine and threonine residues by MAPKKKs and subsequently phosphorylates downstream MAPK targets at threonine and tyrosine residues. A similar protein in mouse has been reported to play a role in liver organogenesis. A pseudogene of this gene is located on the long arm of chromosome X. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP2K4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP2K4.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAP2K4
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: NLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMA
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.6-0.7 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MAP2K4 (ARP30544_T100-HRP) antibody is Catalog # AAP30544
Printable datasheet for anti-MAP2K4 (ARP30544_T100-HRP) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...