Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DMRTD Antibody - N-terminal region : FITC (ARP39744_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP39744_P050 Unconjugated

ARP39744_P050-HRP Conjugated

ARP39744_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DMRTD
NCBI Gene Id:
63946
Swissprot Id:
Q8IXT2
Protein Accession #:
XP_005259205
Alias Symbols:
DMRTC2,
Description of Target:
DMRTD may be involved in sexual development.
Protein Size (# AA):
367
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DMRTD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DMRTD.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DMRTD
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TXNRD1; IRF9;
Blocking Peptide:
For anti-DMRTD (ARP39744_P050-FITC) antibody is Catalog # AAP39744
Datasheets/Manuals:
Printable datasheet for anti-DMRTD (ARP39744_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Tell us what you think about this item!

Write A Review
    Please, wait...