website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LDHA antibody - N-terminal region (ARP54776_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP54776_P050-FITC Conjugated

ARP54776_P050-HRP Conjugated

ARP54776_P050-Biotin Conjugated

Gene Symbol:
LDHA
NCBI Gene Id:
3939
Official Gene Full Name:
Lactate dehydrogenase A
Protein Name:
L-lactate dehydrogenase A chain
Swissprot Id:
P00338
Protein Accession #:
NP_005557
Nucleotide Accession #:
NM_005566
Alias Symbols:
LDH-M, LDH1, PIG19, LDHM, GSD11
Replacement Item:
This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Description of Target:
LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
332
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-LDHA (ARP54776_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
Blocking Peptide:
For anti-LDHA (ARP54776_P050) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Datasheets / Downloads:
Printable datasheet for anti-LDHA (ARP54776_P050) antibody
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Target Reference:
Listerman,I., PLoS Genet. 3 (11), E212 (2007)

Customer Reviews for LDHA Antibody (ARP54776_P050) tested with LdhA transgenic kidney and testis using Western Blot

CAT#ARP54776

Conclusion: this N-terminal antibody has absolute specificity in reactivity with the individual isozymes.

- Erwin Goldberg, Professor
Department of Molecular Biosciences
Northwestern University

Product Protocols: LDHA antibody tested with Human Placenta Tissue (ARP54776_P050)

Aviva Systems Biology is the original manufacturer of this LDHA antibody (ARP54776_P050)

Click here to view the LDHA antibody Western Blot Protocol

Product Datasheet Link: LDHA antibody (ARP54776_P050)

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Placenta

Western Blot image:


Description of Target: LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s LDHA antibody (ARP54776_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...