Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LDHA Antibody - N-terminal region (ARP54776_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP54776_P050-FITC Conjugated

ARP54776_P050-HRP Conjugated

ARP54776_P050-Biotin Conjugated

Gene Symbol:
LDHA
NCBI Gene Id:
3939
Official Gene Full Name:
lactate dehydrogenase A
Protein Name:
L-lactate dehydrogenase A chain
Swissprot Id:
P00338
Protein Accession #:
NP_005557
Nucleotide Accession #:
NM_005566
Alias Symbols:
LDHM, GSD11, PIG19, HEL-S-133P
Replacement Item:
This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Protein Size (# AA):
332
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-LDHA (ARP54776_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
Blocking Peptide:
For anti-LDHA (ARP54776_P050) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Datasheets/Manuals:
Printable datasheet for anti-LDHA (ARP54776_P050) antibody
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Target Reference:
Listerman,I., PLoS Genet. 3 (11), E212 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...