Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

prd antibody - middle region : FITC (ARP47857_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock

Conjugation Options

ARP47857_P050 Unconjugated

ARP47857_P050-HRP Conjugated

ARP47857_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Segmentation protein paired
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Dmel_CG6716, CG6716, Prd, pr, Dmel\CG6716, PRD
Description of Target:
Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express prd.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express prd.
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Predicted Homology Based on Immunogen Sequence:
Fruit fly: 100%
Complete computational species homology data:
Anti-prd (ARP47857_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
ci; Rassf; Ras85D; Mlf; Damm; Mer; CG42676; gsb; CycE; LIMK1; dm;
Blocking Peptide:
For anti-prd (ARP47857_P050-FITC) antibody is Catalog # AAP47857 (Previous Catalog # AAPP27301)
Printable datasheet for anti-prd (ARP47857_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...