Aviva Systems Biology office will be closed for Christmas and New Year Holidays - December 22nd-25th, 2017 and January 1st, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

pb antibody - middle region : FITC (ARP47877_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP47877_P050 Unconjugated

ARP47877_P050-HRP Conjugated

ARP47877_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
pb
NCBI Gene Id:
40826
Official Gene Full Name:
Proboscipedia
Protein Name:
Homeotic protein proboscipedia
Swissprot Id:
P31264
Protein Accession #:
NP_996163
Nucleotide Accession #:
NM_206441
Alias Symbols:
Dmel_CG31481, CG31481, PB, l(3)04498, pd, BG:DS01719.1, CG17880, Dmel\CG31481, Dmpb, Pb
Description of Target:
Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.
Protein Size (# AA):
777
Molecular Weight:
83kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express pb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express pb.
Predicted Homology Based on Immunogen Sequence:
Fruit fly:100%;
Complete computational species homology data:
Anti-pb (ARP47877_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
skd; ey; H; MED17; Scr; lab; eyg; RasGAP1; d;
Blocking Peptide:
For anti-pb (ARP47877_P050-FITC) antibody is Catalog # AAP47877 (Previous Catalog # AAPP27321)
Datasheets / Downloads:
Printable datasheet for anti-pb (ARP47877_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...