Now Offering Over 102,157 Antibodies & 44,722 Antigens!

hb antibody - N-terminal region : HRP (ARP47827_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP47827_P050 Unconjugated

ARP47827_P050-FITC Conjugated

ARP47827_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Protein hunchback
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Dmel_CG9786, CG9786, Hb, Rg-bx, Rg-pbx, hbHLH, Dmel\CG9786, HB, Hunchback, l(3)85Ah, R-pbx
Description of Target:
Hb is a gap class segmentation protein that controls development of head structures.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express hb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express hb.
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Rat: 100%
Complete computational species homology data:
Anti-hb (ARP47827_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.6-0.7 mg/ml
Protein Interactions:
nos; Larp7; pho; tsl; bnl; ftz; bcd; kni; ple; Kr; pum;
Blocking Peptide:
For anti-hb (ARP47827_P050-HRP) antibody is Catalog # AAP47827 (Previous Catalog # AAPS19007)
Datasheets / Downloads:
Printable datasheet for anti-hb (ARP47827_P050-HRP) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...