Aviva Systems Biology office will be closed for Christmas and New Year Holidays - December 22nd-25th, 2017 and January 1st, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

hb antibody - N-terminal region (ARP47827_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP47827_P050-FITC Conjugated

ARP47827_P050-HRP Conjugated

ARP47827_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
hb
NCBI Gene Id:
41032
Official Gene Full Name:
Hunchback
Protein Name:
Protein hunchback
Swissprot Id:
P05084
Protein Accession #:
NP_731268
Nucleotide Accession #:
NM_169234
Alias Symbols:
Dmel_CG9786, CG9786, Hb, Rg-bx, Rg-pbx, hbHLH, Dmel\CG9786, HB, Hunchback, l(3)85Ah, R-pbx
Description of Target:
Hb is a gap class segmentation protein that controls development of head structures.
Protein Size (# AA):
758
Molecular Weight:
83kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express hb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express hb.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Species Reactivity:
Rat
Predicted Homology Based on Immunogen Sequence:
Rat: 100%
Complete computational species homology data:
Anti-hb (ARP47827_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
nos; Larp7; pho; tsl; bnl; ftz; bcd; kni; ple; Kr; pum;
Blocking Peptide:
For anti-hb (ARP47827_P050) antibody is Catalog # AAP47827 (Previous Catalog # AAPS19007)
Datasheets / Downloads:
Printable datasheet for anti-hb (ARP47827_P050) antibody

Product Protocols: hb antibody tested with Human Drosophila (ARP47827_P050)

Aviva Systems Biology is the original manufacturer of this hb antibody (ARP47827_P050)

Click here to view the hb antibody Western Blot Protocol

Product Datasheet Link: hb antibody (ARP47827_P050)

WB Suggested Anti-hb Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila

Western Blot image:


Description of Target: Hb is a gap class segmentation protein that controls development of head structures.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s hb antibody (ARP47827_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...