Now Offering Over 102,157 Antibodies & 44,722 Antigens!

hb antibody - N-terminal region (ARP47827_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock

Conjugation Options

ARP47827_P050-FITC Conjugated

ARP47827_P050-HRP Conjugated

ARP47827_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Protein hunchback
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Dmel_CG9786, CG9786, Hb, Rg-bx, Rg-pbx, hbHLH, Dmel\CG9786, HB, Hunchback, l(3)85Ah, R-pbx
Description of Target:
Hb is a gap class segmentation protein that controls development of head structures.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express hb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express hb.
The immunogen is a synthetic peptide corresponding to a middle region of Drosophila hb
Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Drosophila: 100%
Complete computational species homology data:
Anti-hb (ARP47827_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
nos; Larp7; pho; tsl; bnl; ftz; bcd; kni; ple; Kr; pum;
Blocking Peptide:
For anti-hb (ARP47827_P050) antibody is Catalog # AAP47827 (Previous Catalog # AAPS19007)
Printable datasheet for anti-hb (ARP47827_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...