Aviva Systems Biology office will be closed for Christmas and New Year Holidays - December 22nd-25th, 2017 and January 1st, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Antp antibody - C-terminal region : HRP (ARP47884_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP47884_P050 Unconjugated

ARP47884_P050-FITC Conjugated

ARP47884_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Antp
NCBI Gene Id:
40835
Official Gene Full Name:
Antennapedia
Protein Name:
Homeotic protein antennapedia
Swissprot Id:
P02833
Protein Accession #:
NP_996176
Nucleotide Accession #:
NM_206454
Alias Symbols:
Dmel_CG1028, 3.4, ANT-C, ANT-P, Ant, AntP, AntP1, CG1028, DMANTPE1, DRO15DC96Z, DmAntp, Hu, Scx, l(3)84Ba, ANTC, antp, ANTP, Antp P1, Antp P2, Antp1, Aus, BG:DS07700.1, Dmel\CG1028, Ns
Description of Target:
Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.
Protein Size (# AA):
297
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Antp.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Antp.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Predicted Homology Based on Immunogen Sequence:
Fruit fly:100%;
Complete computational species homology data:
Anti-Antp (ARP47884_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Protein Interactions:
Dsp1; spen; ey; ash2; osa; Ubx; mor; trx; hth; Scr; Dfd; lab; Snr1; Pc; Cpr73D; brm; tna; Zasp66; CG4623; CG16985; CG15120; Pcl; CycE; d;
Blocking Peptide:
For anti-Antp (ARP47884_P050-HRP) antibody is Catalog # AAP47884 (Previous Catalog # AAPP27328)
Datasheets / Downloads:
Printable datasheet for anti-Antp (ARP47884_P050-HRP) antibody
Conjugation:
HRP
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...