Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TUBA8 antibody - N-terminal region : Biotin (ARP57298_P050-Biotin)

100 ul
$289.00
In Stock

Conjugation Options

ARP57298_P050 Unconjugated

ARP57298_P050-FITC Conjugated

ARP57298_P050-HRP Conjugated

Gene Symbol:
TUBA8
NCBI Gene Id:
51807
Official Gene Full Name:
Tubulin, alpha 8
Protein Name:
Tubulin alpha-8 chain
Swissprot Id:
Q9NY65
Protein Accession #:
NP_061816
Nucleotide Accession #:
NM_018943
Alias Symbols:
TUBAL2
Replacement Item:
This antibody may replace item sc-105025 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
449
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TUBA8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TUBA8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA8
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-TUBA8 (ARP57298_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TP53; UBC; LGR4; rev; IGSF8; HDAC6; CD81; UBL4A; SHC1; ARRB2; PPP2CA; MEPCE; GRM7; PXN; SIAH1; MYC; TCP1;
Blocking Peptide:
For anti-TUBA8 (ARP57298_P050-Biotin) antibody is Catalog # AAP57298 (Previous Catalog # AAPP44646)
Datasheets/Manuals:
Printable datasheet for anti-TUBA8 (ARP57298_P050-Biotin) antibody
Conjugation:
Biotin

Tell us what you think about this item!

Write A Review
    Please, wait...