Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NEGR1 antibody - N-terminal region : FITC (ARP55701_P050-FITC)

Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP55701_P050 Unconjugated

ARP55701_P050-HRP Conjugated

ARP55701_P050-Biotin Conjugated

Gene Symbol:
NEGR1
NCBI Gene Id:
257194
Official Gene Full Name:
Neuronal growth regulator 1
Protein Name:
Neuronal growth regulator 1
Swissprot Id:
Q7Z3B1
Protein Accession #:
NP_776169
Nucleotide Accession #:
NM_173808
Alias Symbols:
DMML2433, IGLON4, KILON, MGC46680, Ntra
Replacement Item:
This antibody may replace item sc-137625 from Santa Cruz Biotechnology.
Description of Target:
NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.
Protein Size (# AA):
354
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NEGR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NEGR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NEGR1 (ARP55701_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
NEGR1; NTM; LSAMP; Htt;
Blocking Peptide:
For anti-NEGR1 (ARP55701_P050-FITC) antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438)
Datasheets/Manuals:
Printable datasheet for anti-NEGR1 (ARP55701_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...