Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRKAB2 antibody - middle region (ARP56639_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP56639_P050-FITC Conjugated

ARP56639_P050-HRP Conjugated

ARP56639_P050-Biotin Conjugated

Gene Symbol:
PRKAB2
NCBI Gene Id:
5565
Official Gene Full Name:
Protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Name:
5'-AMP-activated protein kinase subunit beta-2
Swissprot Id:
O43741
Protein Accession #:
NP_005390
Nucleotide Accession #:
NM_005399
Alias Symbols:
MGC61468
Replacement Item:
This antibody may replace item sc-100358 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Protein Size (# AA):
272
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKAB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKAB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRKAB2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-PRKAB2 (ARP56639_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAGED1; PIAS2; STX11; BLZF1; TRAF2; STX19; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-9; KRTAP10-7; CCDC36; KRT40; RHEBL1; UBXN11; CREB3L1; RIMBP3; KRTAP4-2; KRTAP9-4; LZTS2; KRTAP9-2; KRTAP4-12; CCDC33; BEND5; GATAD2B; BANP; FAM208B; GET4; KLF15; IKZF3; IK
Blocking Peptide:
For anti-PRKAB2 (ARP56639_P050) antibody is Catalog # AAP56639 (Previous Catalog # AAPP39344)
Datasheets/Manuals:
Printable datasheet for anti-PRKAB2 (ARP56639_P050) antibody
Subunit:
beta-2
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...