Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRKAA2 antibody - middle region (ARP56697_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP56697_P050-FITC Conjugated

ARP56697_P050-HRP Conjugated

ARP56697_P050-Biotin Conjugated

Gene Symbol:
PRKAA2
NCBI Gene Id:
5563
Official Gene Full Name:
Protein kinase, AMP-activated, alpha 2 catalytic subunit
Protein Name:
5'-AMP-activated protein kinase catalytic subunit alpha-2
Swissprot Id:
P54646
Protein Accession #:
NP_006243
Nucleotide Accession #:
NM_006252
Alias Symbols:
AMPK, AMPK2, PRKAA, AMPKa2
Replacement Item:
This antibody may replace item sc-19129 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that
Protein Size (# AA):
552
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKAA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKAA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PRKAA2 (ARP56697_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KCTD1; NUTM1; RFX6; KIF24; RBPMS; APPBP2; ABI2; AIMP2; TRIP6; TCF4; VPS52; PRKAG1; PRKAB2; L3MBTL3; ZNF397; USHBP1; TSC22D4; HMBOX1; CCNB1IP1; HOMEZ; NECAB2; ZBTB8A; NOTCH2NL; KRTAP10-3; NONO; KRT31; KIFC3; GLI1; FOS; AES; PPARG; UBC; HSP90AA1; WWP1; RPTO
Blocking Peptide:
For anti-PRKAA2 (ARP56697_P050) antibody is Catalog # AAP56697 (Previous Catalog # AAPP39507)
Datasheets/Manuals:
Printable datasheet for anti-PRKAA2 (ARP56697_P050) antibody
Subunit:
alpha-2
Target Reference:
Qin,S. (2008) J. Biol. Chem. 283 (11), 6744-6751

Tell us what you think about this item!

Write A Review
    Please, wait...