Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRKAA1 antibody - middle region (ARP53652_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP53652_P050-FITC Conjugated

ARP53652_P050-HRP Conjugated

ARP53652_P050-Biotin Conjugated

Gene Symbol:
PRKAA1
NCBI Gene Id:
5562
Official Gene Full Name:
Protein kinase, AMP-activated, alpha 1 catalytic subunit
Protein Name:
5'-AMP-activated protein kinase catalytic subunit alpha-1
Swissprot Id:
Q13131
Protein Accession #:
NP_006242
Nucleotide Accession #:
NM_006251
Alias Symbols:
AMPK, AMPKa1, MGC33776, MGC57364
Replacement Item:
This antibody may replace item sc-130394 from Santa Cruz Biotechnology.
Description of Target:
PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein Size (# AA):
559
Molecular Weight:
63kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKAA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKAA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRKAA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-PRKAA1 (ARP53652_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRKAG1; PRKAB2; PRKAB1; GOLGA2; PHC2; CTBP1; CDX4; AES; Trp53; INO80E; RFX6; TRIM27; KRT40; SSX2IP; PNMA5; UBXN11; RIMBP3; L3MBTL3; TSC22D4; VPS37B; HMBOX1; HOMEZ; THAP1; ROPN1; RAD54B; MTUS2; IKZF3; RBPMS; ABI2; ZBED1; BHLHE40; TRIP6; STK11; VPS52; PPARG
Blocking Peptide:
For anti-PRKAA1 (ARP53652_P050) antibody is Catalog # AAP53652 (Previous Catalog # AAPP30492)
Datasheets/Manuals:
Printable datasheet for anti-PRKAA1 (ARP53652_P050) antibody
Subunit:
alpha-1
Target Reference:
Hasumi,H., Gene 415 (1-2), 60-67 (2008)

Tell us what you think about this item!

Write A Review
    Please, wait...