Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PREP antibody - N-terminal region (ARP56413_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP56413_P050-FITC Conjugated

ARP56413_P050-HRP Conjugated

ARP56413_P050-Biotin Conjugated

Gene Symbol:
PREP
NCBI Gene Id:
5550
Official Gene Full Name:
Prolyl endopeptidase
Protein Name:
Prolyl endopeptidase
Swissprot Id:
P48147
Protein Accession #:
NP_002717
Nucleotide Accession #:
NM_002726
Alias Symbols:
MGC16060, PE, PEP
Replacement Item:
This antibody may replace item sc-365416 from Santa Cruz Biotechnology.
Description of Target:
PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d
Protein Size (# AA):
710
Molecular Weight:
81kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PREP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PREP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PREP
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-PREP (ARP56413_P050)
Peptide Sequence:
Synthetic peptide located within the following region: THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; BRCA1; TARS; UBD; SIRT7; UBC; OXT; NTS; TAC1; KNG1; AGT;
Blocking Peptide:
For anti-PREP (ARP56413_P050) antibody is Catalog # AAP56413 (Previous Catalog # AAPP38722)
Datasheets/Manuals:
Printable datasheet for anti-PREP (ARP56413_P050) antibody
Target Reference:
Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374

Tell us what you think about this item!

Write A Review
    Please, wait...