Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PPARGC1A antibody - N-terminal region (ARP39015_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP39015_P050-FITC Conjugated

ARP39015_P050-HRP Conjugated

ARP39015_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Replacement Item:
This antibody may replace item sc-13067 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPARGC1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A.
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Complete computational species homology data:
Anti-PPARGC1A (ARP39015_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PPARGC1A (ARP39015_P050) antibody is Catalog # AAP39015 (Previous Catalog # AAPS03708)
Printable datasheet for anti-PPARGC1A (ARP39015_P050) antibody

Roque, CG; Wong, HH; Lin, JQ; Holt, CE; Tumor protein Tctp regulates axon development in the embryonic visual system. 143, 1134-48 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26903505

Tell us what you think about this item!

Write A Review
    Please, wait...