Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ppargc1a antibody - middle region (ARP40129_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40129_P050-FITC Conjugated

ARP40129_P050-HRP Conjugated

ARP40129_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Peroxisome proliferative activated receptor, gamma, coactivator 1 alpha
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
A830037N07Rik, PGC-1, PGC-1v, Pgc-1alpha, Pgc1, Pgco1, Ppargc1, Gm11133, ENSMUSG00000079510
Replacement Item:
This antibody may replace item sc-13067 from Santa Cruz Biotechnology.
Description of Target:
Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ppargc1a.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ppargc1a.
The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 83%; Goat: 86%; Guinea Pig: 92%; Horse: 92%; Human: 83%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Sheep: 79%
Complete computational species homology data:
Anti-Ppargc1a (ARP40129_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Yy1; Akt1; Pparg; Cdk7; Mybbp1a; Sirt1; Hnf4a; Nr5a1; Lhb; NR1I2; Esrra; Nr1h3; Ncoa1; Foxo1; Pck1; G6pc;
Blocking Peptide:
For anti-Ppargc1a (ARP40129_P050) antibody is Catalog # AAP40129 (Previous Catalog # AAPP20403)
Printable datasheet for anti-Ppargc1a (ARP40129_P050) antibody
Target Reference:
Finck,B.N. (2006) J. Clin. Invest. 116 (3), 615-622

Tell us what you think about this item!

Write A Review
    Please, wait...