Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PMS2 antibody - middle region (ARP56117_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP56117_P050-FITC Conjugated

ARP56117_P050-HRP Conjugated

ARP56117_P050-Biotin Conjugated

Gene Symbol:
PMS2
NCBI Gene Id:
5395
Official Gene Full Name:
PMS2 postmeiotic segregation increased 2 (S. cerevisiae)
Protein Name:
Mismatch repair endonuclease PMS2
Swissprot Id:
P54278
Protein Accession #:
NP_000526
Nucleotide Accession #:
NM_000535
Alias Symbols:
HNPCC4, PMS2CL, PMSL2
Replacement Item:
This antibody may replace item sc-11440 from Santa Cruz Biotechnology.
Description of Target:
PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.This gene is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.
Protein Size (# AA):
862
Molecular Weight:
96kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PMS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PMS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PMS2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Rabbit: 92%; Rat: 92%; Yeast: 91%
Complete computational species homology data:
Anti-PMS2 (ARP56117_P050)
Peptide Sequence:
Synthetic peptide located within the following region: INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MLH1; PCNA; PMS2P1; NSF; MSH2; LMNA; MSH6; SPRTN; BRIP1; FAN1; CLSPN; TOPBP1; PSD2; MMS19; ATAD3A; NSUN2; UBR5; COPG2; PSD3; COPG1; RUVBL2; EXO1; AIFM1; RUVBL1; XPO1; SMARCA4; RFC2; PSMD5; PSMC6; PSMC3; PSMC2; PSMC1; PRKDC; PPP2CA; PIK3C2A; MSH3; MCM
Blocking Peptide:
For anti-PMS2 (ARP56117_P050) antibody is Catalog # AAP56117 (Previous Catalog # AAPP37738)
Datasheets/Manuals:
Printable datasheet for anti-PMS2 (ARP56117_P050) antibody
Sample Type Confirmation:

PMS2 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Jackson,C.C., (2008) Pediatr Blood Cancer 50 (6), 1268-1270

Tell us what you think about this item!

Write A Review
    Please, wait...