Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PML antibody - middle region (ARP39753_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP39753_P050-FITC Conjugated

ARP39753_P050-HRP Conjugated

ARP39753_P050-Biotin Conjugated

Gene Symbol:
PML
NCBI Gene Id:
5371
Official Gene Full Name:
Promyelocytic leukemia
Protein Name:
Protein PML
Swissprot Id:
P29590
Protein Accession #:
NP_150241
Nucleotide Accession #:
NM_033238
Alias Symbols:
MYL, PP8675, RNF71, TRIM19
Replacement Item:
This antibody may replace item sc-18423 from Santa Cruz Biotechnology.
Description of Target:
PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor an
Protein Size (# AA):
882
Molecular Weight:
97kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PML.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PML.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PML
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PML (ARP39753_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPL11; RPL5; SUMO1; UBC; TP53; SUMO2; SUMO3; MDM2; RNF4; EGFR; NCOA2; SP100; DAXX; MAPK7; HDAC1; ATXN1; ATRX; ASF1A; EHMT2; HIRA; HTT; H3F3A; ATF7IP; PML; JAK1; EIF4E; GLIS2; UBE2I; smt3; HDAC11; HDAC6; LMNA; RNF111; CDK6; CDK2; CDK1; CASP8AP2; RBX1; SH3G
Blocking Peptide:
For anti-PML (ARP39753_P050) antibody is Catalog # AAP39753 (Previous Catalog # AAPP21778)
Datasheets/Manuals:
Printable datasheet for anti-PML (ARP39753_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that PML is expressed in ACHN

Specificity:
isoform 1, 9, 10 and 11 specific
Target Reference:
Eun,B., (2008) J. Biol. Chem. 283 (9), 5939-5949
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...