Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PLPP1 Antibody - middle region (ARP42146_T100)

100 ul
$229.00
In Stock

Conjugation Options

ARP42146_T100-FITC Conjugated

ARP42146_T100-HRP Conjugated

ARP42146_T100-Biotin Conjugated

Gene Symbol:
PLPP1
NCBI Gene Id:
8611
Official Gene Full Name:
phospholipid phosphatase 1
Protein Name:
phospholipid phosphatase 1
Swissprot Id:
O14494-2
Protein Accession #:
NP_795714
Nucleotide Accession #:
NM_176895
Alias Symbols:
LPP1, PAP2, LLP1a, PAP-2a, PPAP2A
Replacement Item:
This antibody may replace item sc-133882 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.
Protein Size (# AA):
285
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLPP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLPP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PPAP2A
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PPAP2A (ARP42146_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAHD1; IGF2BP2; ILF3; UBC; FXYD1;
Blocking Peptide:
For anti-PLPP1 (ARP42146_T100) antibody is Catalog # AAP42146 (Previous Catalog # AAPP12565)
Datasheets/Manuals:
Printable datasheet for anti-PLPP1 (ARP42146_T100) antibody
Target Reference:
Tanyi,J.L., Clin. Cancer Res. 9 (10 PT 1), 3534-3545 (2003)

Tell us what you think about this item!

Write A Review
    Please, wait...