Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PKLR antibody - N-terminal region (ARP41699_T100)

100 ul
In Stock

Conjugation Options

ARP41699_T100-FITC Conjugated

ARP41699_T100-HRP Conjugated

ARP41699_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Pyruvate kinase, liver and RBC
Protein Name:
Pyruvate kinase isozymes R/L
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133222 from Santa Cruz Biotechnology.
Description of Target:
PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).The protein encoded by this gene is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PKLR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PKLR.
The immunogen is a synthetic peptide directed towards the N terminal region of human PKLR
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-PKLR (ARP41699_T100)
Peptide Sequence:
Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PKLR (ARP41699_T100) antibody is Catalog # AAP41699 (Previous Catalog # AAPP24342)
Printable datasheet for anti-PKLR (ARP41699_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that PKLR is expressed in HepG2

Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Target Reference:
Pendergrass,D.C., (2006) IUBMB Life 58 (1), 31-38

Tell us what you think about this item!

Write A Review
    Please, wait...