Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PDHA1 antibody - N-terminal region (ARP48136_T100)

100 ul
$229.00
In Stock

Conjugation Options

ARP48136_T100-FITC Conjugated

ARP48136_T100-HRP Conjugated

ARP48136_T100-Biotin Conjugated

Gene Symbol:
PDHA1
NCBI Gene Id:
5160
Official Gene Full Name:
Pyruvate dehydrogenase (lipoamide) alpha 1
Protein Name:
Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
Swissprot Id:
P08559
Protein Accession #:
NP_000275
Nucleotide Accession #:
NM_000284
Alias Symbols:
PDHA, PDHCE1A, PHE1A
Replacement Item:
This antibody may replace item sc-133898 from Santa Cruz Biotechnology.
Description of Target:
The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT); and dihydrolipoyl dehydrogenase (DLD). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex.The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT; MIM 608770) (E2; EC 2.3.1.12); and dihydrolipoyl dehydrogenase (DLD; MIM 238331) (E3; EC 1.8.1.4). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex (Brown et al., 1994 [PubMed 7853374]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
390
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDHA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDHA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-PDHA1 (ARP48136_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; SUMO2; UBC; GINS4; DCPS; NCDN; VCL; PPP1R2; MSN; ASL; ADRB2; ITGA4; HNRNPDL; PDHX; SDHA; PDHB; OGDH; GTF2I; DLAT; CUL3; SIRT7; ATG101; WDR20; BABAM1; USP19; PDP1; EIF6; PDK4; PDK3; PDK2; PDK1; PDHA1; DGKE;
Blocking Peptide:
For anti-PDHA1 (ARP48136_T100) antibody is Catalog # AAP48136 (Previous Catalog # AAPP28652)
Datasheets/Manuals:
Printable datasheet for anti-PDHA1 (ARP48136_T100) antibody
Sample Type Confirmation:

PDHA1 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit:
alpha, somatic form, mitochondrial
Target Reference:
Boichard,A., (2008) Mol. Genet. Metab. 93 (3), 323-330

Tell us what you think about this item!

Write A Review
    Please, wait...