Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Pax7 antibody - middle region (ARP30947_P050)

Scroll Horizontally to view all Images

 

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP30947_P050-FITC Conjugated

ARP30947_P050-HRP Conjugated

ARP30947_P050-Biotin Conjugated

Gene Symbol:
Pax7
NCBI Gene Id:
500574
Official Gene Full Name:
Paired box 7
Protein Accession #:
NP_001178913
Nucleotide Accession #:
NM_001191984
Alias Symbols:
RGD1564360
Replacement Item:
This antibody may replace item sc-130019 from Santa Cruz Biotechnology.
Description of Target:
The function of Pax7 remains unknown.
Protein Size (# AA):
503
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pax7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pax7.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human Pax7
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-Pax7 (ARP30947_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Pax7 (ARP30947_P050) antibody is Catalog # AAP30947 (Previous Catalog # AAPP24013)
Datasheets/Manuals:
Printable datasheet for anti-Pax7 (ARP30947_P050) antibody
Publications:

Ezin, A. M., Sechrist, J. W., Zah, A., Bronner, M. & Fraser, S. E. Early regulative ability of the neuroepithelium to form cardiac neural crest. Dev. Biol. 349, 238-49 (2011). IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 21047505

Van Ry, P. M., Minogue, P., Hodges, B. L. & Burkin, D. J. Laminin-111 improves muscle repair in a mouse model of merosin-deficient congenital muscular dystrophy. Hum. Mol. Genet. (2013). doi:10.1093/hmg/ddt428 IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24009313

Customer Reviews for Pax7 Antibody (ARP30947_P050) tested with overexpressed Pax-7 in C2C12 cells in Immunofluorescence

Cat # ARP30947_P050

submitted by:
Pete Zammit
KIng's College London

Recognized Pax7 when over expressed in myogenic C2 cells, but had high background, when compared with the DSHB monoclonal. Detection of endogenous Pax7 in mouse satellite cells again revealed a high background compared to the monoclonal.

Product Protocols: Pax7 antibody tested with Human Rat Muscle Tissue (ARP30947_P050)

Aviva Systems Biology is the original manufacturer of this Pax7 antibody (ARP30947_P050)

Click here to view the Pax7 antibody Western Blot Protocol

Product Datasheet Link: Pax7 antibody (ARP30947_P050)

WB Suggested Anti-Pax7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle

Western Blot image:


Description of Target: The function of Pax7 remains unknown.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s Pax7 antibody (ARP30947_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...