Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PARK7 antibody - C-terminal region (ARP51267_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP51267_P050-FITC Conjugated

ARP51267_P050-HRP Conjugated

ARP51267_P050-Biotin Conjugated

Gene Symbol:
PARK7
NCBI Gene Id:
11315
Official Gene Full Name:
Parkinson protein 7
Protein Name:
Protein DJ-1
Swissprot Id:
Q99497
Protein Accession #:
NP_009193
Nucleotide Accession #:
NM_007262
Alias Symbols:
DJ-1, DJ1, FLJ27376
Replacement Item:
This antibody may replace item sc-125250 from Santa Cruz Biotechnology.
Description of Target:
PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.
Protein Size (# AA):
189
Molecular Weight:
20kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
ARP51267_P050
Peptide Sequence:
Synthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GOPC; VHL; UBC; PARK7; NPM1; BBS1; SNCA; Bax; HIPK1; TDP2; PRDX5; PPARGC1A; FADD; PRDX2; TALDO1; SREBF2; SFPQ; PTEN; NONO; MAP3K5; HSPA4; CASP8; BAG1; ATP5J; AR; PINK1; TP53; SLC18A2; PARK2; NDUFS3; NDUFA4; ND1; MAP1B; CSN1S1; SUMO1; UBE2I; DAXX; UBA2; BC
Blocking Peptide:
Catalog # AAP51267 (Previous Catalog # AAPP28415)
Datasheets/Manuals:
Printable datasheet for ARP51267_P050
Sample Type Confirmation:

PARK7 is supported by BioGPS gene expression data to be expressed in SHSY5Y

Target Reference:
Mellick,G.D., (er) Parkinsonism Relat. Disord. (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...