Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PANX1 antibody - middle region (ARP42783_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42783_P050-FITC Conjugated

ARP42783_P050-HRP Conjugated

ARP42783_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PANX1
NCBI Gene Id:
24145
Official Gene Full Name:
Pannexin 1
Protein Name:
Pannexin-1
Swissprot Id:
Q96RD7
Protein Accession #:
NP_056183
Nucleotide Accession #:
NM_015368
Alias Symbols:
MGC21309, MRS1, UNQ2529, PX1
Description of Target:
PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.
Protein Size (# AA):
426
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PANX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PANX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PANX1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 83%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-PANX1 (ARP42783_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GNAS; UBC; P2RX7;
Blocking Peptide:
For anti-PANX1 (ARP42783_P050) antibody is Catalog # AAP42783 (Previous Catalog # AAPS10109)
Datasheets/Manuals:
Printable datasheet for anti-PANX1 (ARP42783_P050) antibody
Sample Type Confirmation:

PANX1 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Tell us what you think about this item!

Write A Review
    Please, wait...